PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 396aa    MW: 44929.8 Da    PI: 7.7556
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.86.7e-303890154
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                    kprl+Wt++LHerF+eav+qLGG++kAtPkt+l+lm+++gLtl+h+kSHLQ YR
  XP_012568182.1 38 KPRLKWTTDLHERFIEAVNQLGGADKATPKTVLKLMGIPGLTLYHLKSHLQ-YR 90
                    79************************************************9.67 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3113595IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-283692IPR009057Homeodomain-like
SuperFamilySSF466891.13E-133790IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-203889IPR006447Myb domain, plants
PfamPF002493.3E-84088IPR001005SANT/Myb domain
PfamPF143792.0E-25138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MYYNHHQQAR NMHALRMQIQ GGGNGSGDSG LVLSTDAKPR LKWTTDLHER FIEAVNQLGG  60
ADKATPKTVL KLMGIPGLTL YHLKSHLQYR ISKTMNGQTN TGSSKIALTT EVSSRMSEAS  120
GIHMKHLSIG LQTNKNSEIN EAFNMQMEVQ RRLHEQLEVQ KHLQLRIEAQ GKYLQSVLEK  180
AKETLGTQNL GTMGLDDAKV QLSKFTSRVS NENLDSKFLG LKELHVHWPQ QTREDETIDY  240
SMGSFLTNSE DSQRDQEMHN KGMKLGVSKE CVDEPMPLKN DFTLCEKEKE NVMFVSSSNH  300
RVLKDGLTTS LLLMNVGGVH EKENMWKRTI SKEDLKGEEW KRINNIETNG VQLKLNSDKI  360
SQDYRLANFE VKLDLNSNDA SSQCQKFDLN GFSWNC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1395850.0BT139585.1 Medicago truncatula clone JCVI-FLMt-20F6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568182.10.0PREDICTED: uncharacterized protein LOC101512896 isoform X2
TrEMBLA0A072U7680.0A0A072U768_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA16G26820.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-103G2-like family protein